#GENEIOUS CONVERT SEQUENCHER SPF FILE PRO#
pro files are used in Lasergene, a sequence analysis tool produced by DNAStar. Files containing only metadata can be imported onto existing sequences in Geneious, see section 3.2.1ĭNAStar. For more information on importing primers from a spreadsheet, see the PCR Primers section.
![geneious convert sequencher spf file geneious convert sequencher spf file](https://www.snapgene.com/wordpress/wp-content/uploads/2020/10/ABV-SG.png)
For files containing sequences, including nucleotides, proteins, primers or probes, Geneious will create a new document containing the sequence and any additional fields chosen for import. Sequences, primers and metadata information stored in spreadsheets can be uploaded to Geneious if the spreadsheet file is exported in CSV or TSV format. csfasta files represent the color calls generated by the SOLiD sequencing system. HQ625581 MRVMGIPRNWPQWWIWGILGFWIMLMCRVEENSWVTVYYGVPVWKEATTTLFCASDAKAYĪBI. HQ625568 MRVRGTQRNWPQWWIWTSLGFWIILMCR-GNLWVTVYYGVPVWTDAKTTLFCASDAKAY HQ625588 MRVMGKWRNCQQWWIWGILGFWIILICN-AEQLWVTVYYGVPVWKEAKTTLFCASDAKAY HQ625572 MRVKGILKNYQQWWIWVILGFWMLMICNVVGNQWVTVYYGVPVWREAKATLFCASDAKAY HQ625589 MRVKGRSRNYPQWWVWGILGFWMFMICNGVGNRWVTVYYGVPVWKEAKATLFCASDAKAY HQ625570 MRVMGMWRNYPQWWIWGILGLWM-ICSVVGKLWVTVYYGVPVWTDAKATLFCASDAKAY An example Clustal file:ĬLUSTAL W (1.74) multiple sequence alignment
![geneious convert sequencher spf file geneious convert sequencher spf file](https://mlkcvop3gbop.i.optimole.com/tCVzdQ-dpsoTlyU/w:1000/h:600/q:auto/https://www.geneious.com/wp-content/uploads/2019/11/2020-Clustal.png)
Ĭlustal format files are used to store multiple sequence alignments and contain the word clustal at the beginning. The Clustal format is used by the well known multiple sequence alignment programs ClustalW, ClustalX and Clustal Omega. pd4 are not currently supported for import. Currently it does not import other fields, restriction cut sites or primer binding sites. This will import name, description, topology, sequence and annotations. Geneious can import annotated sequences files in the standard Clone Manager molecule format.
![geneious convert sequencher spf file geneious convert sequencher spf file](https://www.snapgene.com/wordpress/wp-content/uploads/2019/02/Multiple-Sequence-Alignment@2x-210x300.png)
You can use a BED file to annotate existing sequences in your local database, import entirely new sequences, or import the annotations onto blank sequences. The BED format contains sequence annotation information. Matching Geneious document fields to your spreadsheetģ.2.2 Importing Vector NTI Databases BED annotations CSV/TSV (Comma/Tab Separated Values) sequencesģ.2.1 Importing metadata from a spreadsheet onto existing documents